Lineage for d1sebh2 (1seb H:127-235)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934366Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2934389Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 2934390Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries)
  8. 2934414Domain d1sebh2: 1seb H:127-235 [37784]
    Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebb2, d1sebd1, d1sebe1, d1sebe2, d1sebf1, d1sebf2, d1sebh1

Details for d1sebh2

PDB Entry: 1seb (more details), 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb
PDB Compounds: (H:) enterotoxin type b

SCOPe Domain Sequences for d1sebh2:

Sequence, based on SEQRES records: (download)

>d1sebh2 d.15.6.1 (H:127-235) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
dkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgy
ikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylt

Sequence, based on observed residues (ATOM records): (download)

>d1sebh2 d.15.6.1 (H:127-235) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
dkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyetgyikfiene
nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylt

SCOPe Domain Coordinates for d1sebh2:

Click to download the PDB-style file with coordinates for d1sebh2.
(The format of our PDB-style files is described here.)

Timeline for d1sebh2: