Lineage for d1sebf1 (1seb F:93-192)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747484Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2747492Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 2747539Domain d1sebf1: 1seb F:93-192 [21604]
    Other proteins in same PDB: d1seba1, d1seba2, d1sebb2, d1sebd1, d1sebd2, d1sebe1, d1sebe2, d1sebf2, d1sebh1, d1sebh2

Details for d1sebf1

PDB Entry: 1seb (more details), 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb
PDB Compounds: (F:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1sebf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sebf1 b.1.1.2 (F:93-192) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewrars

SCOPe Domain Coordinates for d1sebf1:

Click to download the PDB-style file with coordinates for d1sebf1.
(The format of our PDB-style files is described here.)

Timeline for d1sebf1: