Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries) Uniprot P01903 28-207 |
Domain d1seba2: 1seb A:1-81 [38175] Other proteins in same PDB: d1seba1, d1sebb1, d1sebb2, d1sebd1, d1sebd2, d1sebe1, d1sebf1, d1sebf2, d1sebh1, d1sebh2 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1seb (more details), 2.7 Å
SCOPe Domain Sequences for d1seba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1seba2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]} ikeehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgal aniavdkanleimtkrsnytp
Timeline for d1seba2: