SCOPe 2.08: Domain d1seba2: 1seb A:1-81

Lineage for d1seba2 (1seb A:1-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
   Uniprot P01903 28-207

8. Domain d1seba2: 1seb A:1-81 [38175]
   Other proteins in same PDB: d1seba1, d1sebb1, d1sebb2, d1sebd1, d1sebd2, d1sebe1, d1sebf1, d1sebf2, d1sebh1, d1sebh2
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1seba2

PDB Entry: 1seb, 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb

PDB Compounds: (A:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1seba2:

Sequence; same for both SEQRES and ATOM records:

>d1seba2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
ikeehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgal
aniavdkanleimtkrsnytp

Timeline for d1seba2:

• d1seba2 first appeared (with stable ids) in SCOP 1.55
  
• d1seba2 appears in SCOPe 2.07