Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Ralstonia pickettii [TaxId:329] [376570] (1 PDB entry) |
Domain d6qptf1: 6qpt F:6-163 [376596] automated match to d5tb7a1 complexed with cu, no2, pg4 |
PDB Entry: 6qpt (more details), 1.9 Å
SCOPe Domain Sequences for d6qptf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qptf1 b.6.1.0 (F:6-163) automated matches {Ralstonia pickettii [TaxId: 329]} pgdfgpprgepihavltspplvpppvnrtypakvivelevvekemqisegvsytfwtfgg tvpgsfirvrqgdtvefhlknhpsskmphnidlhgvtgpgggaassftapghesqftfka lnegiyvyhcatapvgmhiangmyglilveppeglpkv
Timeline for d6qptf1: