Lineage for d5tb7a1 (5tb7 A:52-203)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382262Species Neisseria gonorrhoeae [TaxId:242231] [255756] (4 PDB entries)
  8. 2382265Domain d5tb7a1: 5tb7 A:52-203 [329303]
    Other proteins in same PDB: d5tb7a2, d5tb7b2, d5tb7c2
    automated match to d1kbva1
    complexed with cu, po4

Details for d5tb7a1

PDB Entry: 5tb7 (more details), 1.9 Å

PDB Description: structure of nitrite reductase ania from neisseria gonorrhoeae, space group p212121
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d5tb7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tb7a1 b.6.1.0 (A:52-203) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
gelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrm
irvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpgly
iyhcavapvgmhiangmyglilvepkeglpkv

SCOPe Domain Coordinates for d5tb7a1:

Click to download the PDB-style file with coordinates for d5tb7a1.
(The format of our PDB-style files is described here.)

Timeline for d5tb7a1: