Lineage for d6qptf2 (6qpt F:164-325)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382379Species Ralstonia pickettii [TaxId:329] [376570] (1 PDB entry)
  8. 2382391Domain d6qptf2: 6qpt F:164-325 [376597]
    automated match to d5tb7a2
    complexed with cu, no2, pg4

Details for d6qptf2

PDB Entry: 6qpt (more details), 1.9 Å

PDB Description: crystal structure of nitrite bound synthetic core domain of nitrite reductase from ralstonia pickettii (residues 1-331)
PDB Compounds: (F:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6qptf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qptf2 b.6.1.0 (F:164-325) automated matches {Ralstonia pickettii [TaxId: 329]}
dheyyvmqgdfytagkyrekglqpfdmekaiderpsyvlfngaegaltgdkalhakvget
vrifvgnggpnlvssfhvigaifdqvryeggtnvqknvqttlipaggaavvkftarvpgs
yvlvdhsifrafnkgamailkidgaenklvysgkeldsvylg

SCOPe Domain Coordinates for d6qptf2:

Click to download the PDB-style file with coordinates for d6qptf2.
(The format of our PDB-style files is described here.)

Timeline for d6qptf2: