Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Ralstonia pickettii [TaxId:329] [376570] (1 PDB entry) |
Domain d6qptd2: 6qpt D:164-324 [376572] automated match to d5tb7a2 complexed with cu, no2, pg4 |
PDB Entry: 6qpt (more details), 1.9 Å
SCOPe Domain Sequences for d6qptd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qptd2 b.6.1.0 (D:164-324) automated matches {Ralstonia pickettii [TaxId: 329]} dheyyvmqgdfytagkyrekglqpfdmekaiderpsyvlfngaegaltgdkalhakvget vrifvgnggpnlvssfhvigaifdqvryeggtnvqknvqttlipaggaavvkftarvpgs yvlvdhsifrafnkgamailkidgaenklvysgkeldsvyl
Timeline for d6qptd2: