SCOPe 2.07: Domain d6qptb2: 6qpt B:164-324

Lineage for d6qptb2 (6qpt B:164-324)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (29 species)
   not a true protein

7. Species Ralstonia pickettii [TaxId:329] [376570] (1 PDB entry)

8. Domain d6qptb2: 6qpt B:164-324 [376631]
   automated match to d5tb7a2
   complexed with cu, no2, pg4

Details for d6qptb2

PDB Entry: 6qpt, 1.9 Å

PDB Description: crystal structure of nitrite bound synthetic core domain of nitrite reductase from ralstonia pickettii (residues 1-331)

PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6qptb2:

Sequence; same for both SEQRES and ATOM records:

>d6qptb2 b.6.1.0 (B:164-324) automated matches {Ralstonia pickettii [TaxId: 329]}
dheyyvmqgdfytagkyrekglqpfdmekaiderpsyvlfngaegaltgdkalhakvget
vrifvgnggpnlvssfhvigaifdqvryeggtnvqknvqttlipaggaavvkftarvpgs
yvlvdhsifrafnkgamailkidgaenklvysgkeldsvyl

Timeline for d6qptb2:

• d6qptb2 is new in SCOPe 2.07-stable
  
• d6qptb2 appears in the current release, SCOPe 2.08