Lineage for d6q3sa1 (6q3s A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937671Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (9 PDB entries)
  8. 2937681Domain d6q3sa1: 6q3s A:1-181 [372060]
    Other proteins in same PDB: d6q3sa2, d6q3sb1, d6q3sb2, d6q3sd1, d6q3sd2, d6q3se1, d6q3se2
    automated match to d4l29a1
    complexed with act, gol

Details for d6q3sa1

PDB Entry: 6q3s (more details), 2.5 Å

PDB Description: engineered human hla_a2 mhc class i molecule in complex with tcr and sv9 peptide
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d6q3sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q3sa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgcynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmcaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d6q3sa1:

Click to download the PDB-style file with coordinates for d6q3sa1.
(The format of our PDB-style files is described here.)

Timeline for d6q3sa1: