SCOPe 2.08: Domain d6q3sa2: 6q3s A:182-274

Lineage for d6q3sa2 (6q3s A:182-274)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6q3sa2: 6q3s A:182-274 [372061]
   Other proteins in same PDB: d6q3sa1, d6q3sb1, d6q3sb2, d6q3sd1, d6q3sd2, d6q3se1, d6q3se2
   automated match to d1ogaa1
   complexed with act, gol

Details for d6q3sa2

PDB Entry: 6q3s, 2.5 Å

PDB Description: engineered human hla_a2 mhc class i molecule in complex with tcr and sv9 peptide

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d6q3sa2:

Sequence; same for both SEQRES and ATOM records:

>d6q3sa2 b.1.1.0 (A:182-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrw

Timeline for d6q3sa2:

• d6q3sa2 first appeared in SCOPe 2.07