Lineage for d6q3sd1 (6q3s D:2-115)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (21 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (228 PDB entries)
  8. 3072042Domain d6q3sd1: 6q3s D:2-115 [372104]
    Other proteins in same PDB: d6q3sa1, d6q3sa2, d6q3sb1, d6q3sb2, d6q3sd2, d6q3se1, d6q3se2
    automated match to d2f54d1
    complexed with act, gol

Details for d6q3sd1

PDB Entry: 6q3s (more details), 2.5 Å

PDB Description: engineered human hla_a2 mhc class i molecule in complex with tcr and sv9 peptide
PDB Compounds: (D:) T cell receptor alpha variable 21,T-cell receptor, sp3.4 alpha chain

SCOPe Domain Sequences for d6q3sd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q3sd1 b.1.1.1 (D:2-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqtsgr
lnasldkssgrstlyiaasqpgdsatylcavrptsggsyiptfgrgtslivhpy

SCOPe Domain Coordinates for d6q3sd1:

Click to download the PDB-style file with coordinates for d6q3sd1.
(The format of our PDB-style files is described here.)

Timeline for d6q3sd1: