SCOPe 2.08: Domain d6mnnb1: 6mnn B:1-111

Lineage for d6mnnb1 (6mnn B:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6mnnb1: 6mnn B:1-111 [370641]
   Other proteins in same PDB: d6mnna2, d6mnnb2, d6mnnc1, d6mnnc2
   automated match to d3rugf1

Details for d6mnnb1

PDB Entry: 6mnn, 2.83 Å

PDB Description: 6236 tcr bound to i-ab padi4

PDB Compounds: (B:) 6236 TCR beta chain

SCOPe Domain Sequences for d6mnnb1:

Sequence; same for both SEQRES and ATOM records:

>d6mnnb1 b.1.1.0 (B:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdfwgdtlyfgagtrlsvle

Timeline for d6mnnb1:

• d6mnnb1 first appeared in SCOPe 2.07