Lineage for d6mnna2 (6mnn A:116-203)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (16 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (581 PDB entries)
  8. 3070559Domain d6mnna2: 6mnn A:116-203 [370621]
    Other proteins in same PDB: d6mnna1, d6mnnb1, d6mnnc1, d6mnnc2
    automated match to d2f54d2

Details for d6mnna2

PDB Entry: 6mnn (more details), 2.83 Å

PDB Description: 6236 tcr bound to i-ab padi4
PDB Compounds: (A:) 6236 TCR alpha chain

SCOPe Domain Sequences for d6mnna2:

Sequence, based on SEQRES records: (download)

>d6mnna2 b.1.1.2 (A:116-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d6mnna2 b.1.1.2 (A:116-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
sndfacanafnnsiipedtffp

SCOPe Domain Coordinates for d6mnna2:

Click to download the PDB-style file with coordinates for d6mnna2.
(The format of our PDB-style files is described here.)

Timeline for d6mnna2:

  • d6mnna2 appears in periodic updates to SCOPe 2.07 starting on 2019-07-21