Lineage for d1slya2 (1sly A:451-618)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1014746Family d.2.1.6: Bacterial muramidase, catalytic domain [53991] (2 proteins)
    the large N-terminal domain is all-alpha superhelix
  6. 1014757Protein 70 kDa soluble lytic transglycosylase, SLT70 [53992] (1 species)
  7. 1014758Species Escherichia coli [TaxId:562] [53993] (3 PDB entries)
  8. 1014761Domain d1slya2: 1sly A:451-618 [36990]
    Other proteins in same PDB: d1slya1
    complexed with blg

Details for d1slya2

PDB Entry: 1sly (more details), 2.8 Å

PDB Description: complex of the 70-kda soluble lytic transglycosylase with bulgecin a
PDB Compounds: (A:) 70-kda soluble lytic transglycosylase

SCOPe Domain Sequences for d1slya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slya2 d.2.1.6 (A:451-618) 70 kDa soluble lytic transglycosylase, SLT70 {Escherichia coli [TaxId: 562]}
layndlfkrytsgkeipqsyamaiarqesawnpkvkspvgasglmqimpgtathtvkmfs
ipgysspgqlldpetninigtsylqyvyqqfgnnrifssaaynaglgrvrtwlgnsagri
davafvesipfsetrgyvknvlaydayyryfmgdkptlmsatewgrry

SCOPe Domain Coordinates for d1slya2:

Click to download the PDB-style file with coordinates for d1slya2.
(The format of our PDB-style files is described here.)

Timeline for d1slya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1slya1