PDB entry 1sly

View 1sly on RCSB PDB site
Description: complex of the 70-kda soluble lytic transglycosylase with bulgecin a
Class: glycosyltransferase
Keywords: inhibitor-enzyme complex, lysozyme, peptidoglycan, hydrolase, glycosidase, periplasmic, glycosyltransferase
Deposited on 1995-08-02, released 1996-08-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.185
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 70-kda soluble lytic transglycosylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1slya1, d1slya2
  • Heterogens: BLG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1slyA (A:)
    dsldeqrsryaqikqawdnrqmdvveqmmpglkdyplypyleyrqitddlmnqpavtvtn
    fvranptlppartlqsrfvnelarredwrgllafspekpgtteaqcnyyyakwntgqsee
    awqgakelwltgksqpnacdklfsvwrasgkqdplaylerirlamkagntglvtvlagqm
    padyqtiasaiislannpntvltfarttgatdftrqmaavafasvarqdaenarlmipsl
    aqaqqlnedqiqelrdivawrlmgndvtdeqakwrddaimrsqstslierrvrmalgtgd
    rrglntwlarlpmeakekdewrywqadlllergreaeakeilhqlmqqrgfypmvaaqri
    geeyelkidkapqnvdsaltqgpemarvrelmywnldntarsewanlvkskskteqaqla
    ryafnnqwwdlsvqatiagklwdhleerfplayndlfkrytsgkeipqsyamaiarqesa
    wnpkvkspvgasglmqimpgtathtvkmfsipgysspgqlldpetninigtsylqyvyqq
    fgnnrifssaaynaglgrvrtwlgnsagridavafvesipfsetrgyvknvlaydayyry
    fmgdkptlmsatewgrry