Lineage for d1sly_2 (1sly 451-618)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.6: Bacterial muramidase, catalytic domain [53991] (2 proteins) Protein 70 kDa soluble lytic transglycosylase, SLT70 [53992] (1 species) Species Escherichia coli [TaxId:562] [53993] (3 PDB entries) 
Domain d1sly_2: 1sly 451-618 [36990]
Other proteins in same PDB: d1sly_1
Details for d1sly_2
PDB Entry: 1sly (more details), 2.8 Å
PDB Description: complex of the 70-kda soluble lytic transglycosylase with bulgecin a
SCOP Domain Sequences for d1sly_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sly_2 d.2.1.6 (451-618) 70 kDa soluble lytic transglycosylase, SLT70 {Escherichia coli}
layndlfkrytsgkeipqsyamaiarqesawnpkvkspvgasglmqimpgtathtvkmfs
ipgysspgqlldpetninigtsylqyvyqqfgnnrifssaaynaglgrvrtwlgnsagri
davafvesipfsetrgyvknvlaydayyryfmgdkptlmsatewgrry
SCOP Domain Coordinates for d1sly_2:
Click to download the PDB-style file with coordinates for d1sly_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sly_2:
- d1sly_2 appears in SCOP 1.57
- d1sly_2 appears in the current release, SCOPe 2.08, called d1slya2
View in 3D
