SCOPe 2.08: Domain d1slya2: 1sly A:451-618

Lineage for d1slya2 (1sly A:451-618)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.6: Bacterial muramidase, catalytic domain [53991] (2 proteins)
   the large N-terminal domain is all-alpha superhelix

6. Protein 70 kDa soluble lytic transglycosylase, SLT70 [53992] (1 species)

7. Species Escherichia coli [TaxId:562] [53993] (3 PDB entries)

8. Domain d1slya2: 1sly A:451-618 [36990]
   Other proteins in same PDB: d1slya1
   complexed with blg
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1slya2

PDB Entry: 1sly, 2.8 Å

PDB Description: complex of the 70-kda soluble lytic transglycosylase with bulgecin a

PDB Compounds: (A:) 70-kda soluble lytic transglycosylase

SCOPe Domain Sequences for d1slya2:

Sequence; same for both SEQRES and ATOM records:

>d1slya2 d.2.1.6 (A:451-618) 70 kDa soluble lytic transglycosylase, SLT70 {Escherichia coli [TaxId: 562]}
layndlfkrytsgkeipqsyamaiarqesawnpkvkspvgasglmqimpgtathtvkmfs
ipgysspgqlldpetninigtsylqyvyqqfgnnrifssaaynaglgrvrtwlgnsagri
davafvesipfsetrgyvknvlaydayyryfmgdkptlmsatewgrry

Timeline for d1slya2:

• d1slya2 first appeared (with stable ids) in SCOP 1.55, called d1sly_2
  
• d1slya2 appears in SCOPe 2.07