SCOPe 2.08: Domain d6h3hd2: 6h3h D:110-215

Lineage for d6h3hd2 (6h3h D:110-215)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88571] (22 PDB entries)
   Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)

8. Domain d6h3hd2: 6h3h D:110-215 [368844]
   Other proteins in same PDB: d6h3ha1, d6h3ha2, d6h3hb1, d6h3hc1, d6h3hc2, d6h3hd1
   automated match to d1ngpl2
   complexed with gol, so4

Details for d6h3hd2

PDB Entry: 6h3h, 1.92 Å

PDB Description: fab fragment of antibody against fullerene c60

PDB Compounds: (D:) Anti-fullerene antibody Fab fragment Light chain

SCOPe Domain Sequences for d6h3hd2:

Sequence; same for both SEQRES and ATOM records:

>d6h3hd2 b.1.1.2 (D:110-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpsk
qsnnkymassyltltarawerhssyscqvtheghtvekslsradcs

Timeline for d6h3hd2:

• d6h3hd2 first appeared in SCOPe 2.07