SCOPe 2.07: Domain d6nknt_: 6nkn T:

Lineage for d6nknt_ (6nkn T:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)
   automatically mapped to Pfam PF02046

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (51 PDB entries)

8. Domain d6nknt_: 6nkn T: [366676]
   Other proteins in same PDB: d6nkna_, d6nknb1, d6nknb2, d6nknc_, d6nknd_, d6nkne_, d6nknf_, d6nknh_, d6nkni_, d6nknj_, d6nknk_, d6nknl_, d6nknm_, d6nknn_, d6nkno1, d6nkno2, d6nknp_, d6nknq_, d6nknr_, d6nkns_, d6nknu_, d6nknv_, d6nknw_, d6nknx_, d6nkny_, d6nknz_
   automated match to d1v54g_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, o, oh, pek, pgv, psc, tgl, zn

Details for d6nknt_

PDB Entry: 6nkn, 2.5 Å

PDB Description: time-resolved sfx structure of the pr intermediate of cytochrome c oxidase at room temperature

PDB Compounds: (T:) Cytochrome c oxidase subunit 6A2, mitochondrial

SCOPe Domain Sequences for d6nknt_:

Sequence; same for both SEQRES and ATOM records:

>d6nknt_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d6nknt_:

• d6nknt_ is new in SCOPe 2.07-stable
  
• d6nknt_ appears in the current release, SCOPe 2.08