Lineage for d6nkng_ (6nkn G:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630322Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 2630323Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 2630324Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 2630325Species Cow (Bos taurus) [TaxId:9913] [81408] (51 PDB entries)
  8. 2630418Domain d6nkng_: 6nkn G: [366720]
    Other proteins in same PDB: d6nkna_, d6nknb1, d6nknb2, d6nknc_, d6nknd_, d6nkne_, d6nknf_, d6nknh_, d6nkni_, d6nknj_, d6nknk_, d6nknl_, d6nknm_, d6nknn_, d6nkno1, d6nkno2, d6nknp_, d6nknq_, d6nknr_, d6nkns_, d6nknu_, d6nknv_, d6nknw_, d6nknx_, d6nkny_, d6nknz_
    automated match to d1v54g_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, o, oh, pek, pgv, psc, tgl, zn

Details for d6nkng_

PDB Entry: 6nkn (more details), 2.5 Å

PDB Description: time-resolved sfx structure of the pr intermediate of cytochrome c oxidase at room temperature
PDB Compounds: (G:) Cytochrome c oxidase subunit 6A2, mitochondrial

SCOPe Domain Sequences for d6nkng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nkng_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d6nkng_:

Click to download the PDB-style file with coordinates for d6nkng_.
(The format of our PDB-style files is described here.)

Timeline for d6nkng_: