Lineage for d6nknd_ (6nkn D:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630216Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
    automatically mapped to Pfam PF02936
  5. 2630217Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)
  6. 2630218Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2630219Species Cow (Bos taurus) [TaxId:9913] [81403] (28 PDB entries)
  8. 2630265Domain d6nknd_: 6nkn D: [366574]
    Other proteins in same PDB: d6nkna_, d6nknb1, d6nknb2, d6nknc_, d6nkne_, d6nknf_, d6nkng_, d6nknh_, d6nkni_, d6nknj_, d6nknk_, d6nknl_, d6nknm_, d6nknn_, d6nkno1, d6nkno2, d6nknp_, d6nknr_, d6nkns_, d6nknt_, d6nknu_, d6nknv_, d6nknw_, d6nknx_, d6nkny_, d6nknz_
    automated match to d1v54d_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, o, oh, pek, pgv, psc, tgl, zn

Details for d6nknd_

PDB Entry: 6nkn (more details), 2.5 Å

PDB Description: time-resolved sfx structure of the pr intermediate of cytochrome c oxidase at room temperature
PDB Compounds: (D:) cytochrome c oxidase subunit 4 isoform 1, mitochondrial

SCOPe Domain Sequences for d6nknd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nknd_ f.23.1.1 (D:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOPe Domain Coordinates for d6nknd_:

Click to download the PDB-style file with coordinates for d6nknd_.
(The format of our PDB-style files is described here.)

Timeline for d6nknd_: