SCOPe 2.07: Domain d6nkns_: 6nkn S:

Lineage for d6nkns_ (6nkn S:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
   membrane-anchored rubredoxin-like domain
   automatically mapped to Pfam PF01215

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (49 PDB entries)

8. Domain d6nkns_: 6nkn S: [366671]
   Other proteins in same PDB: d6nkna_, d6nknb1, d6nknb2, d6nknc_, d6nknd_, d6nkne_, d6nkng_, d6nknh_, d6nkni_, d6nknj_, d6nknk_, d6nknl_, d6nknm_, d6nknn_, d6nkno1, d6nkno2, d6nknp_, d6nknq_, d6nknr_, d6nknt_, d6nknu_, d6nknv_, d6nknw_, d6nknx_, d6nkny_, d6nknz_
   automated match to d1v54f_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, o, oh, pek, pgv, psc, tgl, zn

Details for d6nkns_

PDB Entry: 6nkn, 2.5 Å

PDB Description: time-resolved sfx structure of the pr intermediate of cytochrome c oxidase at room temperature

PDB Compounds: (S:) cytochrome c oxidase subunit 5b, mitochondrial

SCOPe Domain Sequences for d6nkns_:

Sequence; same for both SEQRES and ATOM records:

>d6nkns_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
gggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcic
eednstviwfwlhkgeaqrcpscgthyklvphql

Timeline for d6nkns_:

• d6nkns_ is new in SCOPe 2.07-stable
  
• d6nkns_ appears in the current release, SCOPe 2.08