Lineage for d6nkns_ (6nkn S:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641212Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2641384Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 2641385Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 2641386Species Cow (Bos taurus) [TaxId:9913] [57820] (49 PDB entries)
  8. 2641476Domain d6nkns_: 6nkn S: [366671]
    Other proteins in same PDB: d6nkna_, d6nknb1, d6nknb2, d6nknc_, d6nknd_, d6nkne_, d6nkng_, d6nknh_, d6nkni_, d6nknj_, d6nknk_, d6nknl_, d6nknm_, d6nknn_, d6nkno1, d6nkno2, d6nknp_, d6nknq_, d6nknr_, d6nknt_, d6nknu_, d6nknv_, d6nknw_, d6nknx_, d6nkny_, d6nknz_
    automated match to d1v54f_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, o, oh, pek, pgv, psc, tgl, zn

Details for d6nkns_

PDB Entry: 6nkn (more details), 2.5 Å

PDB Description: time-resolved sfx structure of the pr intermediate of cytochrome c oxidase at room temperature
PDB Compounds: (S:) cytochrome c oxidase subunit 5b, mitochondrial

SCOPe Domain Sequences for d6nkns_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nkns_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
gggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcic
eednstviwfwlhkgeaqrcpscgthyklvphql

SCOPe Domain Coordinates for d6nkns_:

Click to download the PDB-style file with coordinates for d6nkns_.
(The format of our PDB-style files is described here.)

Timeline for d6nkns_: