Lineage for d6nknb1 (6nkn B:1-90)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629435Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2629436Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2629488Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 2629489Species Cow (Bos taurus) [TaxId:9913] [81454] (45 PDB entries)
  8. 2629570Domain d6nknb1: 6nkn B:1-90 [366649]
    Other proteins in same PDB: d6nkna_, d6nknb2, d6nknc_, d6nknd_, d6nkne_, d6nknf_, d6nkng_, d6nknh_, d6nkni_, d6nknj_, d6nknk_, d6nknl_, d6nknm_, d6nknn_, d6nkno2, d6nknp_, d6nknq_, d6nknr_, d6nkns_, d6nknt_, d6nknu_, d6nknv_, d6nknw_, d6nknx_, d6nkny_, d6nknz_
    automated match to d1v54b2
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, o, oh, pek, pgv, psc, tgl, zn

Details for d6nknb1

PDB Entry: 6nkn (more details), 2.5 Å

PDB Description: time-resolved sfx structure of the pr intermediate of cytochrome c oxidase at room temperature
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6nknb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nknb1 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d6nknb1:

Click to download the PDB-style file with coordinates for d6nknb1.
(The format of our PDB-style files is described here.)

Timeline for d6nknb1: