Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries) |
Domain d5z4pb2: 5z4p B:246-438 [362613] Other proteins in same PDB: d5z4pa1, d5z4pb1, d5z4pc1, d5z4pd1, d5z4pe_, d5z4pf1 automated match to d5ca1b2 complexed with 97o, acp, ca, gdp, gol, gtp, imd, mes, mg |
PDB Entry: 5z4p (more details), 2.5 Å
SCOPe Domain Sequences for d5z4pb2:
Sequence, based on SEQRES records: (download)
>d5z4pb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqda
>d5z4pb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsqyraltvpeltqqmfdsknmmaacdprh gryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatf ignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd a
Timeline for d5z4pb2: