Lineage for d5ca1b2 (5ca1 B:244-428)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959214Species Chicken (Gallus gallus) [TaxId:9031] [278823] (2 PDB entries)
  8. 2959215Domain d5ca1b2: 5ca1 B:244-428 [278824]
    Other proteins in same PDB: d5ca1a1, d5ca1b1, d5ca1c1, d5ca1d1, d5ca1e_, d5ca1f1, d5ca1f2, d5ca1f3
    automated match to d3rycd2
    complexed with acp, ca, gdp, gol, gtp, mes, mg, nzo

Details for d5ca1b2

PDB Entry: 5ca1 (more details), 2.4 Å

PDB Description: crystal structure of t2r-ttl-nocodazole complex
PDB Compounds: (B:) Tubulin beta-2 chain

SCOPe Domain Sequences for d5ca1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ca1b2 d.79.2.1 (B:244-428) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

SCOPe Domain Coordinates for d5ca1b2:

Click to download the PDB-style file with coordinates for d5ca1b2.
(The format of our PDB-style files is described here.)

Timeline for d5ca1b2: