SCOPe 2.08: Domain d5z4pe_: 5z4p E:

Lineage for d5z4pe_ (5z4p E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein automated matches [317456] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [362587] (1 PDB entry)

8. Domain d5z4pe_: 5z4p E: [362588]
   Other proteins in same PDB: d5z4pa1, d5z4pa2, d5z4pb1, d5z4pb2, d5z4pc1, d5z4pc2, d5z4pd1, d5z4pd2, d5z4pf1
   automated match to d4i4te_
   complexed with 97o, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5z4pe_

PDB Entry: 5z4p, 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound tca complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5z4pe_:

Sequence, based on SEQRES records:

>d5z4pe_ a.137.10.1 (E:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records):

>d5z4pe_ a.137.10.1 (E:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

Timeline for d5z4pe_:

• d5z4pe_ first appeared in SCOPe 2.07