Lineage for d5z4pe_ (5z4p E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339704Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2339705Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2339780Protein automated matches [317456] (2 species)
    not a true protein
  7. 3062525Species Rattus norvegicus [TaxId:10116] [362587] (1 PDB entry)
  8. 3062526Domain d5z4pe_: 5z4p E: [362588]
    Other proteins in same PDB: d5z4pa1, d5z4pa2, d5z4pb1, d5z4pb2, d5z4pc1, d5z4pc2, d5z4pd1, d5z4pd2, d5z4pf1
    automated match to d4i4te_
    complexed with 97o, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5z4pe_

PDB Entry: 5z4p (more details), 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound tca complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5z4pe_:

Sequence, based on SEQRES records: (download)

>d5z4pe_ a.137.10.1 (E:) automated matches {Rattus norvegicus [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5z4pe_ a.137.10.1 (E:) automated matches {Rattus norvegicus [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d5z4pe_:

Click to download the PDB-style file with coordinates for d5z4pe_.
(The format of our PDB-style files is described here.)

Timeline for d5z4pe_:

  • d5z4pe_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17