Lineage for d5z4pf1 (5z4p F:1-76)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2444095Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2444096Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2444442Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2444443Protein automated matches [226903] (37 species)
    not a true protein
  7. 2444480Species Chicken (Gallus gallus) [TaxId:9031] [311405] (6 PDB entries)
  8. 3062492Domain d5z4pf1: 5z4p F:1-76 [362554]
    Other proteins in same PDB: d5z4pa1, d5z4pa2, d5z4pb1, d5z4pb2, d5z4pc1, d5z4pc2, d5z4pd1, d5z4pd2, d5z4pe_
    automated match to d3tiia1
    complexed with 97o, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5z4pf1

PDB Entry: 5z4p (more details), 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound tca complex
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d5z4pf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z4pf1 c.30.1.0 (F:1-76) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5z4pf1:

Click to download the PDB-style file with coordinates for d5z4pf1.
(The format of our PDB-style files is described here.)

Timeline for d5z4pf1:

  • d5z4pf1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17