Lineage for d5nsfc_ (5nsf C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442472Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2442706Protein automated matches [190581] (10 species)
    not a true protein
  7. 2442728Species Methanocaldococcus jannaschii [TaxId:243232] [193079] (13 PDB entries)
  8. 3062482Domain d5nsfc_: 5nsf C: [362544]
    automated match to d1u7xa_
    complexed with 96z, ca, gol, pg4

Details for d5nsfc_

PDB Entry: 5nsf (more details), 2.43 Å

PDB Description: structure of azuala
PDB Compounds: (C:) Tyrosine--tRNA ligase

SCOPe Domain Sequences for d5nsfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nsfc_ c.26.1.1 (C:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mdefemikrntseiiseeelrevlkkdeksagigfepsgkihlghylqikkmidlqnagf
diiiwladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsehnldkdytlnvyr
lalkttlkrarrsmeliaredenpkvaeviypimqvnaihyngvdvavggmeqrkihmla
rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlknavaeelikile
pirkrl

SCOPe Domain Coordinates for d5nsfc_:

Click to download the PDB-style file with coordinates for d5nsfc_.
(The format of our PDB-style files is described here.)

Timeline for d5nsfc_:

  • d5nsfc_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17