PDB entry 5nsf

View 5nsf on RCSB PDB site
Description: Structure of AzuAla
Class: ligase
Keywords: nncA, ligase
Deposited on 2017-04-26, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine--tRNA ligase
    Species: Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (Start-317)
      • conflict (43)
      • conflict (76)
      • conflict (81)
      • conflict (119-120)
      • conflict (169)
      • conflict (173)
      • conflict (297)
    Domains in SCOPe 2.07: d5nsfa_
  • Chain 'B':
    Compound: Tyrosine--tRNA ligase
    Species: Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (12-317)
      • conflict (43)
      • conflict (76)
      • conflict (81)
      • conflict (119-120)
      • conflict (169)
      • conflict (173)
      • conflict (297)
    Domains in SCOPe 2.07: d5nsfb_
  • Chain 'C':
    Compound: Tyrosine--tRNA ligase
    Species: Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (12-317)
      • conflict (43)
      • conflict (76)
      • conflict (81)
      • conflict (119-120)
      • conflict (169)
      • conflict (173)
      • conflict (297)
    Domains in SCOPe 2.07: d5nsfc_
  • Chain 'D':
    Compound: Tyrosine--tRNA ligase
    Species: Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (Start-317)
      • conflict (43)
      • conflict (76)
      • conflict (81)
      • conflict (119-120)
      • conflict (169)
      • conflict (173)
      • conflict (297)
    Domains in SCOPe 2.07: d5nsfd_
  • Heterogens: 96Z, GOL, CA, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nsfA (A:)
    mrgshhhhhhgsmdefemikrntseiiseeelrevlkkdeksagigfepsgkihlghylq
    ikkmidlqnagfdiiiwladlgaylnqkgeldeirkigdynkkvfeamglkakyvygseh
    nldkdytlnvyrlalkttlkrarrsmeliaredenpkvaeviypimqvnaihyngvdvav
    ggmeqrkihmlarellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikk
    aycpagvvegnpimeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlk
    navaeelikilepirkrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nsfA (A:)
    defemikrntseiiseeelrevlkkdeksagigfepsgkihlghylqikkmidlqnagfd
    iiiwladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsehnldkdytlnvyrl
    alkttlkrarrsmeliaredenpkvaeviypimqvnaihyngvdvavggmeqrkihmlar
    ellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
    meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlknavaeelikilep
    irkrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nsfB (B:)
    mrgshhhhhhgsmdefemikrntseiiseeelrevlkkdeksagigfepsgkihlghylq
    ikkmidlqnagfdiiiwladlgaylnqkgeldeirkigdynkkvfeamglkakyvygseh
    nldkdytlnvyrlalkttlkrarrsmeliaredenpkvaeviypimqvnaihyngvdvav
    ggmeqrkihmlarellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikk
    aycpagvvegnpimeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlk
    navaeelikilepirkrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nsfB (B:)
    mdefemikrntseiiseeelrevlkkdeksagigfepsgkihlghylqikkmidlqnagf
    diiiwladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsehnldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnaihyngvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlknavaeelikile
    pirkrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nsfC (C:)
    mrgshhhhhhgsmdefemikrntseiiseeelrevlkkdeksagigfepsgkihlghylq
    ikkmidlqnagfdiiiwladlgaylnqkgeldeirkigdynkkvfeamglkakyvygseh
    nldkdytlnvyrlalkttlkrarrsmeliaredenpkvaeviypimqvnaihyngvdvav
    ggmeqrkihmlarellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikk
    aycpagvvegnpimeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlk
    navaeelikilepirkrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nsfC (C:)
    mdefemikrntseiiseeelrevlkkdeksagigfepsgkihlghylqikkmidlqnagf
    diiiwladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsehnldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnaihyngvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlknavaeelikile
    pirkrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nsfD (D:)
    mrgshhhhhhgsmdefemikrntseiiseeelrevlkkdeksagigfepsgkihlghylq
    ikkmidlqnagfdiiiwladlgaylnqkgeldeirkigdynkkvfeamglkakyvygseh
    nldkdytlnvyrlalkttlkrarrsmeliaredenpkvaeviypimqvnaihyngvdvav
    ggmeqrkihmlarellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikk
    aycpagvvegnpimeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlk
    navaeelikilepirkrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nsfD (D:)
    defemikrntseiiseeelrevlkkdeksagigfepsgkihlghylqikkmidlqnagfd
    iiiwladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsehnldkdytlnvyrl
    alkttlkrarrsmeliaredenpkvaeviypimqvnaihyngvdvavggmeqrkihmlar
    ellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
    meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlknavaeelikilep
    irkrl