Lineage for d6mufd_ (6muf D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758454Domain d6mufd_: 6muf D: [362358]
    Other proteins in same PDB: d6mufh2, d6mufl2
    automated match to d5c1mb_
    complexed with nag

Details for d6mufd_

PDB Entry: 6muf (more details), 2.91 Å

PDB Description: crystal structure of hiv-1 b41 sosip.664 prefusion env trimer in complex with human antibodies 3h109l and 35o22 at 3.4 angstrom
PDB Compounds: (D:) 35O22 scFv heavy chain portion

SCOPe Domain Sequences for d6mufd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mufd_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgqlvqsgatttkpgssvkiscktsgyrfnfyhinwirqtagrgpewmgwispysgdknl
apafqdrvimttdtevpvtsftstgaaymeirnltsddtgtyfcakgllrdgsstwlpyl
wgqgtllt

SCOPe Domain Coordinates for d6mufd_:

Click to download the PDB-style file with coordinates for d6mufd_.
(The format of our PDB-style files is described here.)

Timeline for d6mufd_: