PDB entry 6muf

View 6muf on RCSB PDB site
Description: Crystal Structure of HIV-1 B41 SOSIP.664 Prefusion Env Trimer in Complex with Human Antibodies 3H109L and 35O22 at 3.4 Angstrom
Class: immune system/inhibitor
Keywords: HIV-1 Envelope Prefusion Trimer, Entry Inhibitors, IMMUNE SYSTEM-INHIBITOR complex
Deposited on 2018-10-23, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3UEZ6
      • engineered mutation (93)
  • Chain 'D':
    Compound: 35O22 scFv heavy chain portion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MUF (0-End)
    Domains in SCOPe 2.07: d6mufd_
  • Chain 'E':
    Compound: 35O22 scFv light chain portion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MUF (0-End)
    Domains in SCOPe 2.07: d6mufe_
  • Chain 'G':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3UES2
      • conflict (476)
  • Chain 'H':
    Compound: 3H109L Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MUF (0-End)
  • Chain 'L':
    Compound: 3H109L Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MUF
    Domains in SCOPe 2.07: d6mufl1, d6mufl2
  • Heterogens: NAG, BMA, MAN

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6mufD (D:)
    qgqlvqsgatttkpgssvkiscktsgyrfnfyhinwirqtagrgpewmgwispysgdknl
    apafqdrvimttdtevpvtsftstgaaymeirnltsddtgtyfcakgllrdgsstwlpyl
    wgqgtlltvssast
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mufD (D:)
    qgqlvqsgatttkpgssvkiscktsgyrfnfyhinwirqtagrgpewmgwispysgdknl
    apafqdrvimttdtevpvtsftstgaaymeirnltsddtgtyfcakgllrdgsstwlpyl
    wgqgtllt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6mufE (E:)
    sqsvltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapg
    isprfsgyksywsayltisdlrpedettyyccsythnsgcvfgtgtkvsvlgqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mufE (E:)
    sqsvltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapg
    isprfsgyksywsayltisdlrpedettyyccsythnsgcvfgtgtkvsvlg
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6mufL (L:)
    svtsyvrplsvalgetasiscgrqalgsravqwyqhrpgqapilliynnqdrpsgiperf
    sgtpdinfgtratltisgveagdeadyychmwdsrsgfswsfggatrltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpmqwkmhksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mufL (L:)
    syvrplsvalgetasiscgrqalgsravqwyqhrpgqapilliynnqdrpsgiperfsgt
    pdinfgtratltisgveagdeadyychmwdsrsgfswsfggatrltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpmqwkmhksyscqvthegstvektvapt