Lineage for d6acff1 (6acf F:1-134)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2466799Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2466800Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2467113Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2467114Protein automated matches [226864] (34 species)
    not a true protein
  7. 3061532Species Geobacillus stearothermophilus [TaxId:272567] [361594] (1 PDB entry)
  8. 3061534Domain d6acff1: 6acf F:1-134 [361596]
    Other proteins in same PDB: d6acfa2, d6acfb2, d6acfc2, d6acfd2, d6acfe2, d6acff2, d6acfg2, d6acfh2
    automated match to d1leha2

Details for d6acff1

PDB Entry: 6acf (more details), 3 Å

PDB Description: structure of leucine dehydrogenase from geobacillus stearothermophilus by cryo-em
PDB Compounds: (F:) leucine dehydrogenase

SCOPe Domain Sequences for d6acff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6acff1 c.58.1.0 (F:1-134) automated matches {Geobacillus stearothermophilus [TaxId: 272567]}
melfqymekydyeqvlfcqdkesglkaiivihdttlgpalggtrmwmynseeealedalr
largmtyknaaaglnlgggktviigdprkdkneamfrafgrfiqglngryitaedvgttv
admdiiyqetdyvt

SCOPe Domain Coordinates for d6acff1:

Click to download the PDB-style file with coordinates for d6acff1.
(The format of our PDB-style files is described here.)

Timeline for d6acff1:

  • d6acff1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27