SCOPe 2.08: Domain d6acfa2: 6acf A:135-367

Lineage for d6acfa2 (6acf A:135-367)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein automated matches [227005] (6 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:272567] [361597] (1 PDB entry)

8. Domain d6acfa2: 6acf A:135-367 [361862]
   Other proteins in same PDB: d6acfa1, d6acfb1, d6acfc1, d6acfd1, d6acfe1, d6acff1, d6acfg1, d6acfh1
   automated match to d1leha1

Details for d6acfa2

PDB Entry: 6acf, 3 Å

PDB Description: structure of leucine dehydrogenase from geobacillus stearothermophilus by cryo-em

PDB Compounds: (A:) leucine dehydrogenase

SCOPe Domain Sequences for d6acfa2:

Sequence; same for both SEQRES and ATOM records:

>d6acfa2 c.2.1.7 (A:135-367) automated matches {Geobacillus stearothermophilus [TaxId: 272567]}
gispefgssgnpspataygvyrgmkaaakeafgsdslegkvvavqgvgnvayhlcrhlhe
egaklivtdinkeavaraveefgakavdpndiygvecdifapcalggiindqtipqlkak
viagsannqlkeprhgdmihemgivyapdyvinaggvinvadelygynreramkkieqiy
dniekvfaiakrdniptyvaadrmaeerietmrkarsqflqnghhilsrrrar

Timeline for d6acfa2:

• d6acfa2 first appeared in SCOPe 2.07