Lineage for d6acfh2 (6acf H:135-367)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845190Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2845468Protein automated matches [227005] (6 species)
    not a true protein
  7. 2845519Species Geobacillus stearothermophilus [TaxId:272567] [361597] (1 PDB entry)
  8. 2845527Domain d6acfh2: 6acf H:135-367 [361902]
    Other proteins in same PDB: d6acfa1, d6acfb1, d6acfc1, d6acfd1, d6acfe1, d6acff1, d6acfg1, d6acfh1
    automated match to d1leha1

Details for d6acfh2

PDB Entry: 6acf (more details), 3 Å

PDB Description: structure of leucine dehydrogenase from geobacillus stearothermophilus by cryo-em
PDB Compounds: (H:) leucine dehydrogenase

SCOPe Domain Sequences for d6acfh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6acfh2 c.2.1.7 (H:135-367) automated matches {Geobacillus stearothermophilus [TaxId: 272567]}
gispefgssgnpspataygvyrgmkaaakeafgsdslegkvvavqgvgnvayhlcrhlhe
egaklivtdinkeavaraveefgakavdpndiygvecdifapcalggiindqtipqlkak
viagsannqlkeprhgdmihemgivyapdyvinaggvinvadelygynreramkkieqiy
dniekvfaiakrdniptyvaadrmaeerietmrkarsqflqnghhilsrrrar

SCOPe Domain Coordinates for d6acfh2:

Click to download the PDB-style file with coordinates for d6acfh2.
(The format of our PDB-style files is described here.)

Timeline for d6acfh2: