PDB entry 6acf

View 6acf on RCSB PDB site
Description: structure of leucine dehydrogenase from Geobacillus stearothermophilus by cryo-EM
Class: oxidoreductase
Keywords: leucine dehydrogense, nad/leucine binding, apo form, oxidoreductase
Deposited on 2018-07-26, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: EM
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucine dehydrogenase
    Species: Geobacillus stearothermophilus 10 [TaxId:272567]
    Gene: GT50_15010
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6acfa1, d6acfa2
  • Chain 'B':
    Compound: leucine dehydrogenase
    Species: Geobacillus stearothermophilus 10 [TaxId:272567]
    Gene: GT50_15010
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6acfb1, d6acfb2
  • Chain 'C':
    Compound: leucine dehydrogenase
    Species: Geobacillus stearothermophilus 10 [TaxId:272567]
    Gene: GT50_15010
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6acfc1, d6acfc2
  • Chain 'D':
    Compound: leucine dehydrogenase
    Species: Geobacillus stearothermophilus 10 [TaxId:272567]
    Gene: GT50_15010
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6acfd1, d6acfd2
  • Chain 'E':
    Compound: leucine dehydrogenase
    Species: Geobacillus stearothermophilus 10 [TaxId:272567]
    Gene: GT50_15010
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6acfe1, d6acfe2
  • Chain 'F':
    Compound: leucine dehydrogenase
    Species: Geobacillus stearothermophilus 10 [TaxId:272567]
    Gene: GT50_15010
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6acff1, d6acff2
  • Chain 'G':
    Compound: leucine dehydrogenase
    Species: Geobacillus stearothermophilus 10 [TaxId:272567]
    Gene: GT50_15010
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6acfg1, d6acfg2
  • Chain 'H':
    Compound: leucine dehydrogenase
    Species: Geobacillus stearothermophilus 10 [TaxId:272567]
    Gene: GT50_15010
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6acfh1, d6acfh2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6acfA (A:)
    melfqymekydyeqvlfcqdkesglkaiivihdttlgpalggtrmwmynseeealedalr
    largmtyknaaaglnlgggktviigdprkdkneamfrafgrfiqglngryitaedvgttv
    admdiiyqetdyvtgispefgssgnpspataygvyrgmkaaakeafgsdslegkvvavqg
    vgnvayhlcrhlheegaklivtdinkeavaraveefgakavdpndiygvecdifapcalg
    giindqtipqlkakviagsannqlkeprhgdmihemgivyapdyvinaggvinvadelyg
    ynreramkkieqiydniekvfaiakrdniptyvaadrmaeerietmrkarsqflqnghhi
    lsrrrar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6acfB (B:)
    melfqymekydyeqvlfcqdkesglkaiivihdttlgpalggtrmwmynseeealedalr
    largmtyknaaaglnlgggktviigdprkdkneamfrafgrfiqglngryitaedvgttv
    admdiiyqetdyvtgispefgssgnpspataygvyrgmkaaakeafgsdslegkvvavqg
    vgnvayhlcrhlheegaklivtdinkeavaraveefgakavdpndiygvecdifapcalg
    giindqtipqlkakviagsannqlkeprhgdmihemgivyapdyvinaggvinvadelyg
    ynreramkkieqiydniekvfaiakrdniptyvaadrmaeerietmrkarsqflqnghhi
    lsrrrar
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6acfC (C:)
    melfqymekydyeqvlfcqdkesglkaiivihdttlgpalggtrmwmynseeealedalr
    largmtyknaaaglnlgggktviigdprkdkneamfrafgrfiqglngryitaedvgttv
    admdiiyqetdyvtgispefgssgnpspataygvyrgmkaaakeafgsdslegkvvavqg
    vgnvayhlcrhlheegaklivtdinkeavaraveefgakavdpndiygvecdifapcalg
    giindqtipqlkakviagsannqlkeprhgdmihemgivyapdyvinaggvinvadelyg
    ynreramkkieqiydniekvfaiakrdniptyvaadrmaeerietmrkarsqflqnghhi
    lsrrrar
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6acfD (D:)
    melfqymekydyeqvlfcqdkesglkaiivihdttlgpalggtrmwmynseeealedalr
    largmtyknaaaglnlgggktviigdprkdkneamfrafgrfiqglngryitaedvgttv
    admdiiyqetdyvtgispefgssgnpspataygvyrgmkaaakeafgsdslegkvvavqg
    vgnvayhlcrhlheegaklivtdinkeavaraveefgakavdpndiygvecdifapcalg
    giindqtipqlkakviagsannqlkeprhgdmihemgivyapdyvinaggvinvadelyg
    ynreramkkieqiydniekvfaiakrdniptyvaadrmaeerietmrkarsqflqnghhi
    lsrrrar
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6acfE (E:)
    melfqymekydyeqvlfcqdkesglkaiivihdttlgpalggtrmwmynseeealedalr
    largmtyknaaaglnlgggktviigdprkdkneamfrafgrfiqglngryitaedvgttv
    admdiiyqetdyvtgispefgssgnpspataygvyrgmkaaakeafgsdslegkvvavqg
    vgnvayhlcrhlheegaklivtdinkeavaraveefgakavdpndiygvecdifapcalg
    giindqtipqlkakviagsannqlkeprhgdmihemgivyapdyvinaggvinvadelyg
    ynreramkkieqiydniekvfaiakrdniptyvaadrmaeerietmrkarsqflqnghhi
    lsrrrar
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6acfF (F:)
    melfqymekydyeqvlfcqdkesglkaiivihdttlgpalggtrmwmynseeealedalr
    largmtyknaaaglnlgggktviigdprkdkneamfrafgrfiqglngryitaedvgttv
    admdiiyqetdyvtgispefgssgnpspataygvyrgmkaaakeafgsdslegkvvavqg
    vgnvayhlcrhlheegaklivtdinkeavaraveefgakavdpndiygvecdifapcalg
    giindqtipqlkakviagsannqlkeprhgdmihemgivyapdyvinaggvinvadelyg
    ynreramkkieqiydniekvfaiakrdniptyvaadrmaeerietmrkarsqflqnghhi
    lsrrrar
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6acfG (G:)
    melfqymekydyeqvlfcqdkesglkaiivihdttlgpalggtrmwmynseeealedalr
    largmtyknaaaglnlgggktviigdprkdkneamfrafgrfiqglngryitaedvgttv
    admdiiyqetdyvtgispefgssgnpspataygvyrgmkaaakeafgsdslegkvvavqg
    vgnvayhlcrhlheegaklivtdinkeavaraveefgakavdpndiygvecdifapcalg
    giindqtipqlkakviagsannqlkeprhgdmihemgivyapdyvinaggvinvadelyg
    ynreramkkieqiydniekvfaiakrdniptyvaadrmaeerietmrkarsqflqnghhi
    lsrrrar
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6acfH (H:)
    melfqymekydyeqvlfcqdkesglkaiivihdttlgpalggtrmwmynseeealedalr
    largmtyknaaaglnlgggktviigdprkdkneamfrafgrfiqglngryitaedvgttv
    admdiiyqetdyvtgispefgssgnpspataygvyrgmkaaakeafgsdslegkvvavqg
    vgnvayhlcrhlheegaklivtdinkeavaraveefgakavdpndiygvecdifapcalg
    giindqtipqlkakviagsannqlkeprhgdmihemgivyapdyvinaggvinvadelyg
    ynreramkkieqiydniekvfaiakrdniptyvaadrmaeerietmrkarsqflqnghhi
    lsrrrar