Lineage for d6cw2b2 (6cw2 B:109-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751978Domain d6cw2b2: 6cw2 B:109-215 [357863]
    Other proteins in same PDB: d6cw2a_, d6cw2b1
    automated match to d4jg1l2
    complexed with zn

Details for d6cw2b2

PDB Entry: 6cw2 (more details), 2.67 Å

PDB Description: crystal structure of a yeast saga transcriptional coactivator ada2/gcn5 hat subcomplex, crystal form 1
PDB Compounds: (B:) Antibody Light Chain

SCOPe Domain Sequences for d6cw2b2:

Sequence, based on SEQRES records: (download)

>d6cw2b2 b.1.1.2 (B:109-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Sequence, based on observed residues (ATOM records): (download)

>d6cw2b2 b.1.1.2 (B:109-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvnsqesvteqdskdstys
lsstltlsyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d6cw2b2:

Click to download the PDB-style file with coordinates for d6cw2b2.
(The format of our PDB-style files is described here.)

Timeline for d6cw2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6cw2b1
View in 3D
Domains from other chains:
(mouse over for more information)
d6cw2a_