SCOPe 2.08: Domain d5ycja1: 5ycj A:2-153

Lineage for d5ycja1 (5ycj A:2-153)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [188226] (7 PDB entries)

8. Domain d5ycja1: 5ycj A:2-153 [357852]
   Other proteins in same PDB: d5ycja2, d5ycjb2
   automated match to d4pnja_
   complexed with hem, imd

Details for d5ycja1

PDB Entry: 5ycj, 1.58 Å

PDB Description: ancestral myoglobin ambwb' of basilosaurus relative (polyphyly) imidazole-ligand

PDB Compounds: (A:) Ancestral myoglobin aMbWb' of Basilosaurus relative (polyphyly)

SCOPe Domain Sequences for d5ycja1:

Sequence; same for both SEQRES and ATOM records:

>d5ycja1 a.1.1.2 (A:2-153) automated matches {Sperm whale (Physeter catodon) [TaxId: 9755]}
lsdgewqlvlniwgkveadvaghgqdvlirlfkghpetlekfdkfkhlkteaemkasedl
kkhgntvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhsrhpg
dfgadaqgamnkalelfrkdiaakykelgfqg

Timeline for d5ycja1:

• d5ycja1 first appeared in SCOPe 2.07, called d5ycja_