Lineage for d5ycja_ (5ycj A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301593Protein automated matches [190359] (42 species)
    not a true protein
  7. 2301902Species Sperm whale (Physeter catodon) [TaxId:9755] [188226] (7 PDB entries)
  8. 3057790Domain d5ycja_: 5ycj A: [357852]
    automated match to d4pnja_
    complexed with hem, imd

Details for d5ycja_

PDB Entry: 5ycj (more details), 1.58 Å

PDB Description: ancestral myoglobin ambwb' of basilosaurus relative (polyphyly) imidazole-ligand
PDB Compounds: (A:) Ancestral myoglobin aMbWb' of Basilosaurus relative (polyphyly)

SCOPe Domain Sequences for d5ycja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ycja_ a.1.1.2 (A:) automated matches {Sperm whale (Physeter catodon) [TaxId: 9755]}
mglsdgewqlvlniwgkveadvaghgqdvlirlfkghpetlekfdkfkhlkteaemkase
dlkkhgntvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgfqg

SCOPe Domain Coordinates for d5ycja_:

Click to download the PDB-style file with coordinates for d5ycja_.
(The format of our PDB-style files is described here.)

Timeline for d5ycja_:

  • d5ycja_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20