PDB entry 5ycj

View 5ycj on RCSB PDB site
Description: Ancestral myoglobin aMbWb' of Basilosaurus relative (polyphyly) imidazole-ligand
Class: oxygen storage
Keywords: Globin, Molecular Archaeology, Ancient protein, Protein evolution, Deep-sea adaptation, OXYGEN STORAGE
Deposited on 2017-09-07, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ancestral myoglobin aMbWb' of Basilosaurus relative (polyphyly)
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YCJ (Start-156)
    Domains in SCOPe 2.07: d5ycja_
  • Chain 'B':
    Compound: Ancestral myoglobin aMbWb' of Basilosaurus relative (polyphyly)
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YCJ (0-156)
    Domains in SCOPe 2.07: d5ycjb_
  • Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ycjA (A:)
    gshmglsdgewqlvlniwgkveadvaghgqdvlirlfkghpetlekfdkfkhlkteaemk
    asedlkkhgntvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlh
    srhpgdfgadaqgamnkalelfrkdiaakykelgfqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ycjA (A:)
    mglsdgewqlvlniwgkveadvaghgqdvlirlfkghpetlekfdkfkhlkteaemkase
    dlkkhgntvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgfqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ycjB (B:)
    gshmglsdgewqlvlniwgkveadvaghgqdvlirlfkghpetlekfdkfkhlkteaemk
    asedlkkhgntvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlh
    srhpgdfgadaqgamnkalelfrkdiaakykelgfqg