Lineage for d5ycjb1 (5ycj B:2-153)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688797Species Sperm whale (Physeter catodon) [TaxId:9755] [188226] (7 PDB entries)
  8. 2688802Domain d5ycjb1: 5ycj B:2-153 [357942]
    Other proteins in same PDB: d5ycja2, d5ycjb2
    automated match to d4pnja_
    complexed with hem, imd

Details for d5ycjb1

PDB Entry: 5ycj (more details), 1.58 Å

PDB Description: ancestral myoglobin ambwb' of basilosaurus relative (polyphyly) imidazole-ligand
PDB Compounds: (B:) Ancestral myoglobin aMbWb' of Basilosaurus relative (polyphyly)

SCOPe Domain Sequences for d5ycjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ycjb1 a.1.1.2 (B:2-153) automated matches {Sperm whale (Physeter catodon) [TaxId: 9755]}
lsdgewqlvlniwgkveadvaghgqdvlirlfkghpetlekfdkfkhlkteaemkasedl
kkhgntvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhsrhpg
dfgadaqgamnkalelfrkdiaakykelgfqg

SCOPe Domain Coordinates for d5ycjb1:

Click to download the PDB-style file with coordinates for d5ycjb1.
(The format of our PDB-style files is described here.)

Timeline for d5ycjb1:

  • d5ycjb1 first appeared in SCOPe 2.07, called d5ycjb_

View in 3D
Domains from same chain:
(mouse over for more information)
d5ycjb2