Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (43 species) not a true protein |
Species Sperm whale (Physeter catodon) [TaxId:9755] [188226] (7 PDB entries) |
Domain d5ycjb1: 5ycj B:2-153 [357942] Other proteins in same PDB: d5ycja2, d5ycjb2 automated match to d4pnja_ complexed with hem, imd |
PDB Entry: 5ycj (more details), 1.58 Å
SCOPe Domain Sequences for d5ycjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ycjb1 a.1.1.2 (B:2-153) automated matches {Sperm whale (Physeter catodon) [TaxId: 9755]} lsdgewqlvlniwgkveadvaghgqdvlirlfkghpetlekfdkfkhlkteaemkasedl kkhgntvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhsrhpg dfgadaqgamnkalelfrkdiaakykelgfqg
Timeline for d5ycjb1: