Lineage for d5of8a2 (5of8 A:167-340)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771509Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)
  7. 2771510Species Achromobacter cycloclastes [TaxId:223] [419325] (60 PDB entries)
  8. 2771527Domain d5of8a2: 5of8 A:167-340 [352584]
    Other proteins in same PDB: d5of8a1
    automated match to d2bw4a2
    complexed with act, cu, no, no2, so4

Details for d5of8a2

PDB Entry: 5of8 (more details), 1.34 Å

PDB Description: cu nitrite reductase serial data at varying temperatures 190k 0.48mgy
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5of8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5of8a2 b.6.1.3 (A:167-340) Nitrite reductase, NIR, C-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

SCOPe Domain Coordinates for d5of8a2:

Click to download the PDB-style file with coordinates for d5of8a2.
(The format of our PDB-style files is described here.)

Timeline for d5of8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5of8a1