Lineage for d2bw4a2 (2bw4 A:167-340)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding siteFamily b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) 
Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) Species Achromobacter cycloclastes [TaxId:223] [419325] (60 PDB entries) 
Domain d2bw4a2: 2bw4 A:167-340 [129321]
Other proteins in same PDB: d2bw4a1
automated match to d1nifa2
complexed with act, cu, mli, so4
has additional insertions and/or extensions that are not grouped together
Details for d2bw4a2
PDB Entry: 2bw4 (more details), 0.9 Å
PDB Description: atomic resolution structure of resting state of the achromobacter cycloclastes cu nitrite reductase
PDB Compounds: (A:) Copper-containing nitrite reductaseSCOPe Domain Sequences for d2bw4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bw4a2 b.6.1.3 (A:167-340) Nitrite reductase, NIR, C-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm
SCOPe Domain Coordinates for d2bw4a2:
Click to download the PDB-style file with coordinates for d2bw4a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bw4a2:
- d2bw4a2 first appeared in SCOP 1.73
- d2bw4a2 appears in SCOPe 2.07
View in 3D
