Lineage for d6bhyb2 (6bhy B:340-443)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759842Domain d6bhyb2: 6bhy B:340-443 [349708]
    automated match to d1hzhh4
    complexed with na, nag

Details for d6bhyb2

PDB Entry: 6bhy (more details), 2.04 Å

PDB Description: mouse immunoglobulin g 2c fc fragment with single glcnac
PDB Compounds: (B:) Igh protein

SCOPe Domain Sequences for d6bhyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bhyb2 b.1.1.0 (B:340-443) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rgpvrapqvyvlpppaeemtkkefsltcmitgflpaeiavdwtsngrteqnykntatvld
sdgsyfmysklrvqkstwergslfacsvvheglhnhlttktisr

SCOPe Domain Coordinates for d6bhyb2:

Click to download the PDB-style file with coordinates for d6bhyb2.
(The format of our PDB-style files is described here.)

Timeline for d6bhyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6bhyb1