SCOPe 2.08: Domain d6bhya2: 6bhy A:340-445

Lineage for d6bhya2 (6bhy A:340-445)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6bhya2: 6bhy A:340-445 [349643]
   automated match to d1hzhh4
   complexed with na, nag

Details for d6bhya2

PDB Entry: 6bhy, 2.04 Å

PDB Description: mouse immunoglobulin g 2c fc fragment with single glcnac

PDB Compounds: (A:) Igh protein

SCOPe Domain Sequences for d6bhya2:

Sequence; same for both SEQRES and ATOM records:

>d6bhya2 b.1.1.0 (A:340-445) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rgpvrapqvyvlpppaeemtkkefsltcmitgflpaeiavdwtsngrteqnykntatvld
sdgsyfmysklrvqkstwergslfacsvvheglhnhlttktisrsl

Timeline for d6bhya2:

• d6bhya2 first appeared in SCOPe 2.07