SCOPe 2.02: Domain d1fj2b_: 1fj2 B:

Lineage for d1fj2b_ (1fj2 B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins)

6. Protein Acyl protein thioesterase 1 [53550] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53551] (1 PDB entry)

8. Domain d1fj2b_: 1fj2 B: [34721]
   complexed with br

Details for d1fj2b_

PDB Entry: 1fj2, 1.5 Å

PDB Description: crystal structure of the human acyl protein thioesterase 1 at 1.5 a resolution

PDB Compounds: (B:) protein (acyl protein thioesterase 1)

SCOPe Domain Sequences for d1fj2b_:

Sequence; same for both SEQRES and ATOM records:

>d1fj2b_ c.69.1.14 (B:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]}
mdpefmstplpaivpaarkataaviflhglgdtghgwaeafagirsshikyicphapvrp
vtlnmnvampswfdiiglspdsqedesgikqaaenikalidqevkngipsnriilggfsq
ggalslytalttqqklagvtalscwlplrasfpqgpigganrdisilqchgdcdplvplm
fgsltveklktlvnpanvtfktyegmmhsscqqemmdvkqfidkllppi

Timeline for d1fj2b_:

• d1fj2b_ first appeared (with stable ids) in SCOP 1.55
  
• d1fj2b_ appears in SCOPe 2.01
  
• d1fj2b_ appears in SCOPe 2.03
  
• d1fj2b_ appears in the current release, SCOPe 2.08, called d1fj2b1