SCOPe 2.08: Domain d1fj2b1: 1fj2 B:1-224

Lineage for d1fj2b1 (1fj2 B:1-224)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins)

6. Protein Acyl protein thioesterase 1 [53550] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53551] (1 PDB entry)

8. Domain d1fj2b1: 1fj2 B:1-224 [34721]
   Other proteins in same PDB: d1fj2a2, d1fj2b2
   complexed with br

Details for d1fj2b1

PDB Entry: 1fj2, 1.5 Å

PDB Description: crystal structure of the human acyl protein thioesterase 1 at 1.5 a resolution

PDB Compounds: (B:) protein (acyl protein thioesterase 1)

SCOPe Domain Sequences for d1fj2b1:

Sequence; same for both SEQRES and ATOM records:

>d1fj2b1 c.69.1.14 (B:1-224) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]}
mstplpaivpaarkataaviflhglgdtghgwaeafagirsshikyicphapvrpvtlnm
nvampswfdiiglspdsqedesgikqaaenikalidqevkngipsnriilggfsqggals
lytalttqqklagvtalscwlplrasfpqgpigganrdisilqchgdcdplvplmfgslt
veklktlvnpanvtfktyegmmhsscqqemmdvkqfidkllppi

Timeline for d1fj2b1:

• d1fj2b1 first appeared (with stable ids) in SCOP 1.55, called d1fj2b_
  
• d1fj2b1 appears in SCOPe 2.07