Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins) |
Protein Acyl protein thioesterase 1 [53550] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [53551] (1 PDB entry) |
Domain d1fj2b1: 1fj2 B:1-224 [34721] Other proteins in same PDB: d1fj2a2, d1fj2b2 complexed with br |
PDB Entry: 1fj2 (more details), 1.5 Å
SCOPe Domain Sequences for d1fj2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fj2b1 c.69.1.14 (B:1-224) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} mstplpaivpaarkataaviflhglgdtghgwaeafagirsshikyicphapvrpvtlnm nvampswfdiiglspdsqedesgikqaaenikalidqevkngipsnriilggfsqggals lytalttqqklagvtalscwlplrasfpqgpigganrdisilqchgdcdplvplmfgslt veklktlvnpanvtfktyegmmhsscqqemmdvkqfidkllppi
Timeline for d1fj2b1: