Lineage for d1fj2b_ (1fj2 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1383138Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins)
  6. 1383139Protein Acyl protein thioesterase 1 [53550] (1 species)
  7. 1383140Species Human (Homo sapiens) [TaxId:9606] [53551] (1 PDB entry)
  8. 1383142Domain d1fj2b_: 1fj2 B: [34721]
    complexed with br

Details for d1fj2b_

PDB Entry: 1fj2 (more details), 1.5 Å

PDB Description: crystal structure of the human acyl protein thioesterase 1 at 1.5 a resolution
PDB Compounds: (B:) protein (acyl protein thioesterase 1)

SCOPe Domain Sequences for d1fj2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fj2b_ c.69.1.14 (B:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]}
mdpefmstplpaivpaarkataaviflhglgdtghgwaeafagirsshikyicphapvrp
vtlnmnvampswfdiiglspdsqedesgikqaaenikalidqevkngipsnriilggfsq
ggalslytalttqqklagvtalscwlplrasfpqgpigganrdisilqchgdcdplvplm
fgsltveklktlvnpanvtfktyegmmhsscqqemmdvkqfidkllppi

SCOPe Domain Coordinates for d1fj2b_:

Click to download the PDB-style file with coordinates for d1fj2b_.
(The format of our PDB-style files is described here.)

Timeline for d1fj2b_: