Lineage for d5n5ua1 (5n5u A:1-306)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
contains a conserved all-alpha subdomain at the C-terminal extension
Protein automated matches [190581] (10 species)
not a true protein
Species Methanocaldococcus jannaschii [TaxId:243232] [193079] (20 PDB entries) 
Domain d5n5ua1: 5n5u A:1-306 [347093]
Other proteins in same PDB: d5n5ua2
automated match to d1u7xa_
protein/RNA complex; complexed with 7n8, amp, cl
Details for d5n5ua1
PDB Entry: 5n5u (more details), 1.6 Å
PDB Description: structure of p-boronophenylalanyl trna synthetase in complex with p- boronophenylalanine and adenosine monophosphate
PDB Compounds: (A:) Tyrosine--tRNA ligaseSCOPe Domain Sequences for d5n5ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n5ua1 c.26.1.1 (A:1-306) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mdefelikrntseiiseeelrevlkkdeksasigfepsgkihlghylqikkmidlqnagf
diiialadlmaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
lalkttlkrarrsmeliaredenpkvaeviypimqvnsihyegvdvavggmeqrkihmla
rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlknavaeelikile
pirkrl
SCOPe Domain Coordinates for d5n5ua1:
Click to download the PDB-style file with coordinates for d5n5ua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5n5ua1:
- d5n5ua1 first appeared in SCOPe 2.07
View in 3D
