Lineage for d5n5ua1 (5n5u A:1-306)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442472Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2442706Protein automated matches [190581] (10 species)
    not a true protein
  7. 2442728Species Methanocaldococcus jannaschii [TaxId:243232] [193079] (17 PDB entries)
  8. 3047031Domain d5n5ua1: 5n5u A:1-306 [347093]
    Other proteins in same PDB: d5n5ua2
    automated match to d1u7xa_
    protein/RNA complex; complexed with 7n8, amp, cl

Details for d5n5ua1

PDB Entry: 5n5u (more details), 1.6 Å

PDB Description: structure of p-boronophenylalanyl trna synthetase in complex with p- boronophenylalanine and adenosine monophosphate
PDB Compounds: (A:) Tyrosine--tRNA ligase

SCOPe Domain Sequences for d5n5ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n5ua1 c.26.1.1 (A:1-306) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mdefelikrntseiiseeelrevlkkdeksasigfepsgkihlghylqikkmidlqnagf
diiialadlmaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
lalkttlkrarrsmeliaredenpkvaeviypimqvnsihyegvdvavggmeqrkihmla
rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlknavaeelikile
pirkrl

SCOPe Domain Coordinates for d5n5ua1:

Click to download the PDB-style file with coordinates for d5n5ua1.
(The format of our PDB-style files is described here.)

Timeline for d5n5ua1:

  • d5n5ua1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5n5ua2