PDB entry 5n5u

View 5n5u on RCSB PDB site
Description: Structure of p-boronophenylalanyl tRNA synthetase in complex with p-boronophenylalanine and adenosine monophosphate
Class: ligase
Keywords: aminoacylation, ligase, non-natural amino acid, synthetic biology
Deposited on 2017-02-14, released 2018-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine--tRNA ligase
    Species: Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (0-305)
      • engineered mutation (5)
      • engineered mutation (31)
      • engineered mutation (64)
      • engineered mutation (69)
      • engineered mutation (157)
      • engineered mutation (161)
      • engineered mutation (285)
      • expression tag (306-308)
    Domains in SCOPe 2.07: d5n5ua1, d5n5ua2
  • Heterogens: AMP, 7N8, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n5uA (A:)
    mdefelikrntseiiseeelrevlkkdeksasigfepsgkihlghylqikkmidlqnagf
    diiialadlmaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnsihyegvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlknavaeelikile
    pirkrlsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n5uA (A:)
    mdefelikrntseiiseeelrevlkkdeksasigfepsgkihlghylqikkmidlqnagf
    diiialadlmaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnsihyegvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlknavaeelikile
    pirkrlsah