Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein automated matches [190231] (14 species) not a true protein |
Species Anabaena sp. [311173] (3 PDB entries) |
Domain d1qoca_: 1qoc A: [344507] automated match to d1j7aa_ complexed with fes; mutant |
PDB Entry: 1qoc (more details), 1.8 Å
SCOPe Domain Sequences for d1qoca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qoca_ d.15.4.1 (A:) automated matches {Anabaena sp.} atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq edqsfldkdqieagyvltcvayptsdvviqthkeadly
Timeline for d1qoca_: