Lineage for d5vagb1 (5vag B:0-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (28 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2299907Domain d5vagb1: 5vag B:0-106 [343208]
    Other proteins in same PDB: d5vagb2
    automated match to d1dn0a1
    complexed with edo

Details for d5vagb1

PDB Entry: 5vag (more details), 1.9 Å

PDB Description: crystal structure of h7-specific antibody m826 in complex with the ha1 domain of hemagglutinin from h7n9 influenza virus
PDB Compounds: (B:) Light chain of antibody m826

SCOPe Domain Sequences for d5vagb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vagb1 b.1.1.0 (B:0-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdiqltqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvp
srfsgsgsgtdftltisslqpedfatyycqqsystprtfgqgtkvei

SCOPe Domain Coordinates for d5vagb1:

Click to download the PDB-style file with coordinates for d5vagb1.
(The format of our PDB-style files is described here.)

Timeline for d5vagb1:

  • d5vagb1 appears in periodic updates to SCOPe 2.06 starting on 2017-12-21